Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mrpl21 Rabbit Polyclonal Antibody (Biotin)

Mrpl21 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

L21mt, MRP-L21, BC028768

UniProt

A8Y5G2

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: LPDPVEETRHHAEVVKRVNELIATGQYGRLFAVVHFASHQWKVTAEDLIL

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

24kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_758456

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Eif2ak3 shRNA (UAS) - Lentiviral mouse Eif2ak3 shRNA (UAS, iRFP) (100)
GTR15302970 1 Vial

Lentiviral mouse Eif2ak3 shRNA (UAS) - Lentiviral mouse Eif2ak3 shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
Recombinant Bacillus megaterium Phosphocarrier protein HPr (ptsH)
MBS1192711-01 0.02 mg (E-Coli)

Recombinant Bacillus megaterium Phosphocarrier protein HPr (ptsH)

Sign In for Pricing
View Details
Recombinant Bacillus megaterium Phosphocarrier protein HPr (ptsH)
MBS1192711-02 0.1 mg (E-Coli)

Recombinant Bacillus megaterium Phosphocarrier protein HPr (ptsH)

Sign In for Pricing
View Details
Recombinant Bacillus megaterium Phosphocarrier protein HPr (ptsH)
MBS1192711-03 0.02 mg (Yeast)

Recombinant Bacillus megaterium Phosphocarrier protein HPr (ptsH)

Sign In for Pricing
View Details
Recombinant Bacillus megaterium Phosphocarrier protein HPr (ptsH)
MBS1192711-04 0.1 mg (Yeast)

Recombinant Bacillus megaterium Phosphocarrier protein HPr (ptsH)

Sign In for Pricing
View Details
Recombinant Bacillus megaterium Phosphocarrier protein HPr (ptsH)
MBS1192711-05 0.02 mg (Baculovirus)

Recombinant Bacillus megaterium Phosphocarrier protein HPr (ptsH)

Sign In for Pricing
View Details