Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CPEB2 Rabbit Polyclonal Antibody (FITC)

CPEB2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

CPEB-2, CPE-BP2, hCPEB-2

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human CPEB2

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: DTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQHGDIDKRVEVKPYVL

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

37kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

XP_949637

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SARS CoV2 Spike S1 C-Term His Tag Protein
21-1008-100 100 µg

SARS CoV2 Spike S1 C-Term His Tag Protein

Sign In for Pricing
View Details
RFTN2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K1813105 3x 1.0 µg

RFTN2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
Anti-Mouse TCR alpha Antibody (H28-710), APC
MBS1586139-01 50 Tests

Anti-Mouse TCR alpha Antibody (H28-710), APC

Sign In for Pricing
View Details
Anti-Mouse TCR alpha Antibody (H28-710), APC
MBS1586139-02 100 Tests

Anti-Mouse TCR alpha Antibody (H28-710), APC

Sign In for Pricing
View Details
Anti-Mouse TCR alpha Antibody (H28-710), APC
MBS1586139-03 5x 100 Tests

Anti-Mouse TCR alpha Antibody (H28-710), APC

Sign In for Pricing
View Details
TCF7L1 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)
46386154 3x 1.0 µg DNA

TCF7L1 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)

Sign In for Pricing
View Details