Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CPEB2 Rabbit Polyclonal Antibody (HRP)

CPEB2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

CPEB-2, CPE-BP2, hCPEB-2

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human CPEB2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: DTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQHGDIDKRVEVKPYVL

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

37kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

XP_949637

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD1b Blocking Peptide
CBP1175-01 1 mg

CD1b Blocking Peptide

Sign In for Pricing
View Details
CD1b Blocking Peptide
CBP1175-02 5 mg

CD1b Blocking Peptide

Sign In for Pricing
View Details
Acy3 3'UTR GFP Stable Cell Line
TU151345 1.0 mL

Acy3 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Recombinant Thermococcus gammatolerans Translation initiation factor 2 subunit beta (eIF2B)
MBS1023747-01 0.02 mg (E-Coli)

Recombinant Thermococcus gammatolerans Translation initiation factor 2 subunit beta (eIF2B)

Sign In for Pricing
View Details
Recombinant Thermococcus gammatolerans Translation initiation factor 2 subunit beta (eIF2B)
MBS1023747-02 0.1 mg (E-Coli)

Recombinant Thermococcus gammatolerans Translation initiation factor 2 subunit beta (eIF2B)

Sign In for Pricing
View Details
Recombinant Thermococcus gammatolerans Translation initiation factor 2 subunit beta (eIF2B)
MBS1023747-03 0.02 mg (Yeast)

Recombinant Thermococcus gammatolerans Translation initiation factor 2 subunit beta (eIF2B)

Sign In for Pricing
View Details