Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NSUN6 Rabbit Polyclonal Antibody (HRP)

NSUN6 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

NOPD1, ARL5B-AS1, 4933414E04Rik

UniProt

Q8TEA1

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human NSUN6

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SIFPKISLRPEVENYLKEGFMNKEIVTALGKQEAERKFETLLKHLSHPPS

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

52kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit

Tested Applications

WB

NCBI Accession Number

NP_872349

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human Granzyme M Protein - (Dry Ice)
H00003004-Q01-10ug 10 µg

Recombinant Human Granzyme M Protein - (Dry Ice)

Sign In for Pricing
View Details
Human IgG4 Fc Antibody : Biotin
OASB02558-500UG 0.5 mg

Human IgG4 Fc Antibody : Biotin

Sign In for Pricing
View Details
MDFIC, NT (MyoD Family Inhibitor Domain Containing Protein, HIC, I-mfa Domain-containing Protein) (PE)
MBS6487446-01 0.2 mL

MDFIC, NT (MyoD Family Inhibitor Domain Containing Protein, HIC, I-mfa Domain-containing Protein) (PE)

Sign In for Pricing
View Details
MDFIC, NT (MyoD Family Inhibitor Domain Containing Protein, HIC, I-mfa Domain-containing Protein) (PE)
MBS6487446-02 5x 0.2 mL

MDFIC, NT (MyoD Family Inhibitor Domain Containing Protein, HIC, I-mfa Domain-containing Protein) (PE)

Sign In for Pricing
View Details
Recombinant Hepatitis Be Antigen (HBeAg VLP)
OPEF01786-1MG 1 mg

Recombinant Hepatitis Be Antigen (HBeAg VLP)

Sign In for Pricing
View Details
CPT1B Antibody : FITC (OABF01514-FITC)
OABF01514-FITC 100 µL

CPT1B Antibody : FITC (OABF01514-FITC)

Sign In for Pricing
View Details