Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NSUN6 Rabbit Polyclonal Antibody (HRP)

NSUN6 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

NOPD1, ARL5B-AS1, 4933414E04Rik

UniProt

Q8TEA1

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human NSUN6

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MSIFPKISLRPEVENYLKEGFMNKEIVTALGKQEAERKFETLLKHLSHPP

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

52kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Yeast

Tested Applications

WB

NCBI Accession Number

NP_872349

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Firsocostat 100mg
A21000-100 100 mg

Firsocostat 100mg

Sign In for Pricing
View Details
Biotin-Linked Monoclonal Antibody to Ferritin, Light Polypeptide (FTL)
MBS2143966-01 0.1 mL

Biotin-Linked Monoclonal Antibody to Ferritin, Light Polypeptide (FTL)

Sign In for Pricing
View Details
Biotin-Linked Monoclonal Antibody to Ferritin, Light Polypeptide (FTL)
MBS2143966-02 0.2 mL

Biotin-Linked Monoclonal Antibody to Ferritin, Light Polypeptide (FTL)

Sign In for Pricing
View Details
Biotin-Linked Monoclonal Antibody to Ferritin, Light Polypeptide (FTL)
MBS2143966-03 0.5 mL

Biotin-Linked Monoclonal Antibody to Ferritin, Light Polypeptide (FTL)

Sign In for Pricing
View Details
Biotin-Linked Monoclonal Antibody to Ferritin, Light Polypeptide (FTL)
MBS2143966-04 1 mL

Biotin-Linked Monoclonal Antibody to Ferritin, Light Polypeptide (FTL)

Sign In for Pricing
View Details
Biotin-Linked Monoclonal Antibody to Ferritin, Light Polypeptide (FTL)
MBS2143966-05 5 mL

Biotin-Linked Monoclonal Antibody to Ferritin, Light Polypeptide (FTL)

Sign In for Pricing
View Details