Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ANKRD42 Rabbit Polyclonal Antibody (Biotin)

ANKRD42 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

SARP, PPP1R79

UniProt

Q8N9B4

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ANKRD42

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: MPGVANSGPSTSSRETANPCSRKKVHFGSIHDAVRAGDVKQLSEIVCLHW

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

43kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_872409

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CRMP1 (Dihydropyrimidinase-related Protein 1, DRP-1, Collapsin Response Mediator Protein 1, CRMP-1, Unc-33-like Phosphoprotein 3, ULIP-3, DPYSL1, ULIP3) (MaxLight 650)
MBS6221642-01 0.1 mL

CRMP1 (Dihydropyrimidinase-related Protein 1, DRP-1, Collapsin Response Mediator Protein 1, CRMP-1, Unc-33-like Phosphoprotein 3, ULIP-3, DPYSL1, ULIP3) (MaxLight 650)

Sign In for Pricing
View Details
CRMP1 (Dihydropyrimidinase-related Protein 1, DRP-1, Collapsin Response Mediator Protein 1, CRMP-1, Unc-33-like Phosphoprotein 3, ULIP-3, DPYSL1, ULIP3) (MaxLight 650)
MBS6221642-02 5x 0.1 mL

CRMP1 (Dihydropyrimidinase-related Protein 1, DRP-1, Collapsin Response Mediator Protein 1, CRMP-1, Unc-33-like Phosphoprotein 3, ULIP-3, DPYSL1, ULIP3) (MaxLight 650)

Sign In for Pricing
View Details
Ashless Strengthened Filter Paper Discs VS - 110mm
SLS2213 10 / PCK

Ashless Strengthened Filter Paper Discs VS - 110mm

Sign In for Pricing
View Details
GPR182 (7TMR, Adrenomedullin L1 Receptor, AM-R, AMR, ADMR, Adrenomedullin Receptor, G-Protein-Coupled Receptor 182, HrhAMR, G-Protein Coupled Receptor 182, Gamrh, HAMR, RAMR, G10D)
170681 50 µg

GPR182 (7TMR, Adrenomedullin L1 Receptor, AM-R, AMR, ADMR, Adrenomedullin Receptor, G-Protein-Coupled Receptor 182, HrhAMR, G-Protein Coupled Receptor 182, Gamrh, HAMR, RAMR, G10D)

Sign In for Pricing
View Details
Edaravone (MCI-186)
MBS386033-01 500 mg

Edaravone (MCI-186)

Sign In for Pricing
View Details
Edaravone (MCI-186)
MBS386033-02 1 mg

Edaravone (MCI-186)

Sign In for Pricing
View Details