Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RBPMS2 Rabbit Polyclonal Antibody (HRP)

RBPMS2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

Q6ZRY4

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human RBPMS2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: ANTKMAKSKLMATPNPSNVHPALGAHFIARDPYDLMGAALIPASPEAWAP

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

22kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_919248

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PTRH2 CRISPR Knock Out 293T Cell Line (Human)
38194141 1x 10^6 Cells / 1.0 mL

PTRH2 CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details
Recombinant Rat INS1 Protein, His (Fc)-Avi-tagged
INS1-2732R 50 µg

Recombinant Rat INS1 Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details
SPAM1 Rabbit Polyclonal Antibody
E10G35082 100 µL

SPAM1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Ventral Anterior Homeobox 1 (VAX1) Antibody
abx116598 100 µL

Ventral Anterior Homeobox 1 (VAX1) Antibody

Sign In for Pricing
View Details
Rabbit Monoclonal GCN4 Antibody (C11L34) [DyLight 755]
NBP2-81274IR 0.1 mL

Rabbit Monoclonal GCN4 Antibody (C11L34) [DyLight 755]

Sign In for Pricing
View Details
3,4-Dichlorophenyl isocyanate
sc-223561A 50 g

3,4-Dichlorophenyl isocyanate

Sign In for Pricing
View Details