Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NBEAL1 Rabbit Polyclonal Antibody (FITC)

NBEAL1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

ALS2CR16, ALS2CR17, A530083I02Rik

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human NBEAL1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: KDNDKNMSTEDTKKNSDEKTDEEKITSFASANVSSDQWSLEDRHSLDSNT

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

153kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Guinea pig, Human

Tested Applications

WB

NCBI Accession Number

NP_945183

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human DENND5B activation kit by CRISPRa
GA116005 1 Kit

Human DENND5B activation kit by CRISPRa

Sign In for Pricing
View Details
TRIM50 (NM_178125) Human Recombinant Protein
TP311340M 100 µg

TRIM50 (NM_178125) Human Recombinant Protein

Sign In for Pricing
View Details
PARP3 Antibody
8C13098-AAT 50 µg

PARP3 Antibody

Sign In for Pricing
View Details
Bcl-6 (Follicular Lymphoma Marker) (BCL6/1475), CF568 conjugate, 0.1mg/mL
BNC681475-100 1x 100 µL

Bcl-6 (Follicular Lymphoma Marker) (BCL6/1475), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
(+)-Aromadendrene
TRC-A794200-50MG 50 mg

(+)-Aromadendrene

Sign In for Pricing
View Details
UBE2I Polyclonal Antibody
E-AB-19377-01 20 µL

UBE2I Polyclonal Antibody

Sign In for Pricing
View Details