Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NBEAL1 Rabbit Polyclonal Antibody (FITC)

NBEAL1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

ALS2CR16, ALS2CR17, A530083I02Rik

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human NBEAL1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: KDNDKNMSTEDTKKNSDEKTDEEKITSFASANVSSDQWSLEDRHSLDSNT

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

153kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Guinea pig, Human

Tested Applications

WB

NCBI Accession Number

NP_945183

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PE Rat IgM, κ Isotype Control
RD22364F-01 25 µg

PE Rat IgM, κ Isotype Control

Sign In for Pricing
View Details
PE Rat IgM, κ Isotype Control
RD22364F-02 100 µg

PE Rat IgM, κ Isotype Control

Sign In for Pricing
View Details
7-Keto Cholesterol-d7
TRC-K185052-1MG 1 mg

7-Keto Cholesterol-d7

Sign In for Pricing
View Details
Anti-Zika virus (ZIKV) (strain Zika SPH2015) ZIKV-E/Envelope Protein Monoclonal Antibody
E-AB-V1331-01 20 µL

Anti-Zika virus (ZIKV) (strain Zika SPH2015) ZIKV-E/Envelope Protein Monoclonal Antibody

Sign In for Pricing
View Details
Anti-Zika virus (ZIKV) (strain Zika SPH2015) ZIKV-E/Envelope Protein Monoclonal Antibody
E-AB-V1331-02 100 µL

Anti-Zika virus (ZIKV) (strain Zika SPH2015) ZIKV-E/Envelope Protein Monoclonal Antibody

Sign In for Pricing
View Details
N-Acetyl Glyphosate-d3
TRC-A178248-25MG 25 mg

N-Acetyl Glyphosate-d3

Sign In for Pricing
View Details