Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SF1 Rabbit Polyclonal Antibody (Biotin)

SF1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

BBP, MBBP, ZFM1, ZNF162, D11S636, ZCCHC25

UniProt

Q15637

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human SF1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: APPPPPPPPPGSAGMMIPPRGGDGPSHESEDFPRPLVTLPGRQPQQRPWW

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

69kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Guinea pig, Human, Mouse, Rabbit

Tested Applications

WB

NCBI Accession Number

NP_973724

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CHST4 Protein Vector (Rat) (pPM-C-HA)
PV260016 500 ng

CHST4 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
SPATS1 Antibody (Center) Blocking peptide
MBS9218656-01 0.5 mg

SPATS1 Antibody (Center) Blocking peptide

Sign In for Pricing
View Details
SPATS1 Antibody (Center) Blocking peptide
MBS9218656-02 5x 0.5 mg

SPATS1 Antibody (Center) Blocking peptide

Sign In for Pricing
View Details
Rat Transforming Acidic Coiled-Coil-Containing Protein 3 (TACC3) ELISA Kit
MBS9931619-01 48 Well

Rat Transforming Acidic Coiled-Coil-Containing Protein 3 (TACC3) ELISA Kit

Sign In for Pricing
View Details
Rat Transforming Acidic Coiled-Coil-Containing Protein 3 (TACC3) ELISA Kit
MBS9931619-02 96 Well

Rat Transforming Acidic Coiled-Coil-Containing Protein 3 (TACC3) ELISA Kit

Sign In for Pricing
View Details
Rat Transforming Acidic Coiled-Coil-Containing Protein 3 (TACC3) ELISA Kit
MBS9931619-03 5x 96 Well

Rat Transforming Acidic Coiled-Coil-Containing Protein 3 (TACC3) ELISA Kit

Sign In for Pricing
View Details