Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rpl23a Rabbit Polyclonal Antibody (FITC)

Rpl23a Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

MDA2, MDA20, BC029892

UniProt

P62751

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Rpl23a

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: DVKANKHQIKQAVKKLYDIDVAKVNTLIRPDGEKKAYVRLAPDYDALDVA

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

18kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Sheep, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_997406

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DGKA, CT (Diacylglycerol Kinase alpha, Diglyceride Kinase alpha, DGK-alpha, DAG Kinase alpha, 80kD Diacylglycerol Kinase, DAGK, DAGK1) (AP) discontinued
D3441-80A-AP 200 µL

DGKA, CT (Diacylglycerol Kinase alpha, Diglyceride Kinase alpha, DGK-alpha, DAG Kinase alpha, 80kD Diacylglycerol Kinase, DAGK, DAGK1) (AP) discontinued

Sign In for Pricing
View Details
Bovine Striated Muscle Preferentially Expressed Protein kinase ELISA Kit
MBS7264108-01 48 Well

Bovine Striated Muscle Preferentially Expressed Protein kinase ELISA Kit

Sign In for Pricing
View Details
Bovine Striated Muscle Preferentially Expressed Protein kinase ELISA Kit
MBS7264108-02 96 Well

Bovine Striated Muscle Preferentially Expressed Protein kinase ELISA Kit

Sign In for Pricing
View Details
Bovine Striated Muscle Preferentially Expressed Protein kinase ELISA Kit
MBS7264108-03 5x 96 Well

Bovine Striated Muscle Preferentially Expressed Protein kinase ELISA Kit

Sign In for Pricing
View Details
Bovine Striated Muscle Preferentially Expressed Protein kinase ELISA Kit
MBS7264108-04 10x 96 Well

Bovine Striated Muscle Preferentially Expressed Protein kinase ELISA Kit

Sign In for Pricing
View Details
IgG (Immunoglobulin G) Guinea Pig ELISA Kit
E1894 96 Tests

IgG (Immunoglobulin G) Guinea Pig ELISA Kit

Sign In for Pricing
View Details