Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rpl23a Rabbit Polyclonal Antibody (HRP)

Rpl23a Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

MDA2, MDA20, BC029892

UniProt

P62751

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Rpl23a

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: DVKANKHQIKQAVKKLYDIDVAKVNTLIRPDGEKKAYVRLAPDYDALDVA

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

18kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Sheep, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_997406

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ATL1 Protein Vector (Human) (pPM-N-D-C-HA)
PV324832 500 ng

ATL1 Protein Vector (Human) (pPM-N-D-C-HA)

Sign In for Pricing
View Details
Mouse 14-3-3 Protein zeta/delta (YWHAZ) ELISA Kit
MBS9716612-01 48 Tests

Mouse 14-3-3 Protein zeta/delta (YWHAZ) ELISA Kit

Sign In for Pricing
View Details
Mouse 14-3-3 Protein zeta/delta (YWHAZ) ELISA Kit
MBS9716612-02 96 Tests

Mouse 14-3-3 Protein zeta/delta (YWHAZ) ELISA Kit

Sign In for Pricing
View Details
Mouse 14-3-3 Protein zeta/delta (YWHAZ) ELISA Kit
MBS9716612-03 5x 96 Tests

Mouse 14-3-3 Protein zeta/delta (YWHAZ) ELISA Kit

Sign In for Pricing
View Details
Human HSPD1 Knockout A549 cell line
GTR15403034 1 Vial

Human HSPD1 Knockout A549 cell line

Sign In for Pricing
View Details
MAGEE2 (NM_138703) Human Over-expression Lysate
LS139599-100ug 100 µg

MAGEE2 (NM_138703) Human Over-expression Lysate

Sign In for Pricing
View Details