Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FZD2 Rabbit Polyclonal Antibody (HRP)

FZD2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Fz2, fz-2, fzE2, hFz2, OMOD2

UniProt

Q14332

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human FZD2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MRPRSALPRLLLPLLLLPAAGPAQFHGEKGISIPDHGFCQPISIPLCTDI

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

63kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_001457

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SYNPR Antibody
KC-10680-01 50 μL

SYNPR Antibody

Sign In for Pricing
View Details
SYNPR Antibody
KC-10680-02 100 µL

SYNPR Antibody

Sign In for Pricing
View Details
SYNPR Antibody
KC-10680-03 1 mL

SYNPR Antibody

Sign In for Pricing
View Details
IGHG1 (Center) Rabbit Polyclonal Antibody
AP52168PU-N 400 µL

IGHG1 (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Elab Fluor® Violet 450 Rat IgG2b, κ Isotype Control[LTF-2]
E-AB-F09843Q-01 25 µg

Elab Fluor® Violet 450 Rat IgG2b, κ Isotype Control[LTF-2]

Sign In for Pricing
View Details
Elab Fluor® Violet 450 Rat IgG2b, κ Isotype Control[LTF-2]
E-AB-F09843Q-02 100 µg

Elab Fluor® Violet 450 Rat IgG2b, κ Isotype Control[LTF-2]

Sign In for Pricing
View Details