Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FZD2 Rabbit Polyclonal Antibody (HRP)

FZD2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Fz2, fz-2, fzE2, hFz2, OMOD2

UniProt

Q14332

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human FZD2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MRPRSALPRLLLPLLLLPAAGPAQFHGEKGISIPDHGFCQPISIPLCTDI

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

63kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_001457

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Freeze Dryer BFFT-101-B
BFFT-101-B 1 Unit

Freeze Dryer BFFT-101-B

Sign In for Pricing
View Details
Human Resistin Recombinant Rabbit monoclonal Antibody
HA723659 100 µL

Human Resistin Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
DGKD Rabbit Polyclonal Antibody
AP06741PU-N 100 µg

DGKD Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Oct-1 (POU2F1) (NM_002697) Human Over-expression Lysate
LC419163 20 µg

Oct-1 (POU2F1) (NM_002697) Human Over-expression Lysate

Sign In for Pricing
View Details
Ecteinascidin 770
TRC-E225900-1MG 1 mg

Ecteinascidin 770

Sign In for Pricing
View Details
MMP3 (Marker of Metastasis and Rheumatoid Arthritis) (1B4), 1mg/mL
BNUM1729-50 1x 50 µL

MMP3 (Marker of Metastasis and Rheumatoid Arthritis) (1B4), 1mg/mL

Sign In for Pricing
View Details