Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FZD5 Rabbit Polyclonal Antibody (HRP)

FZD5 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

HFZ5, C2orf31

UniProt

Q13467

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human FZD5

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: CYLYEQHYRESWEAALTCACPGHDTGQPRAKPEYWVLMLKYFMCLVVGIT

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

62kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

IHC, WB

NCBI Accession Number

NP_003459

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Alpha-fetoprotein Lens Culinaris Agglutiin 3, AFPL3 ELISA Kit
MBS1608631-01 48 Well

Rat Alpha-fetoprotein Lens Culinaris Agglutiin 3, AFPL3 ELISA Kit

Sign In for Pricing
View Details
Rat Alpha-fetoprotein Lens Culinaris Agglutiin 3, AFPL3 ELISA Kit
MBS1608631-02 96 Well

Rat Alpha-fetoprotein Lens Culinaris Agglutiin 3, AFPL3 ELISA Kit

Sign In for Pricing
View Details
Rat Alpha-fetoprotein Lens Culinaris Agglutiin 3, AFPL3 ELISA Kit
MBS1608631-03 5x 96 Well

Rat Alpha-fetoprotein Lens Culinaris Agglutiin 3, AFPL3 ELISA Kit

Sign In for Pricing
View Details
Rat Alpha-fetoprotein Lens Culinaris Agglutiin 3, AFPL3 ELISA Kit
MBS1608631-04 10x 96 Well

Rat Alpha-fetoprotein Lens Culinaris Agglutiin 3, AFPL3 ELISA Kit

Sign In for Pricing
View Details
Ephrin B2 (EFNB2) (NM_004093) Human Tagged Lenti ORF Clone
RC220133L2 10 µg

Ephrin B2 (EFNB2) (NM_004093) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
STM Antibody
orb797432 2 mg

STM Antibody

Sign In for Pricing
View Details