Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

WNT2B Rabbit Polyclonal Antibody (HRP)

WNT2B Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

WNT13

UniProt

Q93097

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human WNT2B

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LRTCWRALSDFRRTGDYLRRRYDGAVQVMATQDGANFTAARQGYRRATRT

Field of Research

Stem Cell & Developmental Biology

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

41kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

IHC, WB

NCBI Accession Number

NP_004176

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human GGTLC2 shRNA (UAS) - Lentiviral human GGTLC2 shRNA (UAS) plasmid
GTR15316018 1 Vial

Lentiviral human GGTLC2 shRNA (UAS) - Lentiviral human GGTLC2 shRNA (UAS) plasmid

Sign In for Pricing
View Details
PTBP1, NT (PTBP1, PTB, Polypyrimidine tract-binding protein 1, 57kD RNA-binding protein PPTB-1, Heterogeneous nuclear ribonucleoprotein I) (MaxLight 750) discontinued
040583-ML750 100 µL

PTBP1, NT (PTBP1, PTB, Polypyrimidine tract-binding protein 1, 57kD RNA-binding protein PPTB-1, Heterogeneous nuclear ribonucleoprotein I) (MaxLight 750) discontinued

Sign In for Pricing
View Details
ELP6 Human Over-expression Lysate
orb1343262 100 µg

ELP6 Human Over-expression Lysate

Sign In for Pricing
View Details
Anti-CTRC Antibody (Detection)
CAP1066-D-01 100 µg

Anti-CTRC Antibody (Detection)

Sign In for Pricing
View Details
Anti-CTRC Antibody (Detection)
CAP1066-D-02 1 mg

Anti-CTRC Antibody (Detection)

Sign In for Pricing
View Details
UBTD2 Antibody
orb195029-01 50 μL

UBTD2 Antibody

Sign In for Pricing
View Details