Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FZD10 Rabbit Polyclonal Antibody (HRP)

FZD10 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Fz10, FzE7, CD350, FZ-10, hFz10

UniProt

Q9ULW2

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human FZD10

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: PIEIPMCKDIGYNMTRMPNLMGHENQREAAIQLHEFAPLVEYGCHGHLRF

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

65kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_009128

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Blocks, Lung
CB524610 1 Block

Frozen Tissue Blocks, Lung

Sign In for Pricing
View Details
DDX54 (NM_001111322) Human Over-expression Lysate
LC426366 20 µg

DDX54 (NM_001111322) Human Over-expression Lysate

Sign In for Pricing
View Details
Ccr9 Mouse Gene Knockout Kit (CRISPR)
KN502842 1 Kit

Ccr9 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Metazachlor Ethane Sulfonic Acid Sodium Salt
TRC-M226233-25MG 25 mg

Metazachlor Ethane Sulfonic Acid Sodium Salt

Sign In for Pricing
View Details
ITGB1BP1 Polyclonal Antibody
E-AB-53077-01 20 µL

ITGB1BP1 Polyclonal Antibody

Sign In for Pricing
View Details
ITGB1BP1 Polyclonal Antibody
E-AB-53077-02 60 µL

ITGB1BP1 Polyclonal Antibody

Sign In for Pricing
View Details