Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FZD10 Rabbit Polyclonal Antibody (Biotin)

FZD10 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Fz10, FzE7, CD350, FZ-10, hFz10

UniProt

Q9ULW2

Immunogen

The immunogen is a synthetic peptide directed towards the following sequence GMWIWTSKTLQSWQQVCSRRLKKKSRRKPASVITSGGIYKKAQHPQKTHH

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: GMWIWTSKTLQSWQQVCSRRLKKKSRRKPASVITSGGIYKKAQHPQKTHH

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

65 kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine

Tested Applications

IF

NCBI Accession Number

NP_009128

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Angiopoietin-related protein 6 ELISA Kit
MBS289956-01 48 Well

Human Angiopoietin-related protein 6 ELISA Kit

Sign In for Pricing
View Details
Human Angiopoietin-related protein 6 ELISA Kit
MBS289956-02 96 Well

Human Angiopoietin-related protein 6 ELISA Kit

Sign In for Pricing
View Details
Human Angiopoietin-related protein 6 ELISA Kit
MBS289956-03 5x 96 Well

Human Angiopoietin-related protein 6 ELISA Kit

Sign In for Pricing
View Details
Human Angiopoietin-related protein 6 ELISA Kit
MBS289956-04 10x 96 Well

Human Angiopoietin-related protein 6 ELISA Kit

Sign In for Pricing
View Details
EIF2D siRNA (Mouse)
orb1846948-01 15 nmol

EIF2D siRNA (Mouse)

Sign In for Pricing
View Details
EIF2D siRNA (Mouse)
orb1846948-02 30 nmol

EIF2D siRNA (Mouse)

Sign In for Pricing
View Details