Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FZD4 Rabbit Polyclonal Antibody (FITC)

FZD4 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Fz4, EVR1, FEVR, Fz-4, FzE4, GPCR, hFz4, CD344, FZD4S

UniProt

Q9ULV1

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of human FZD4

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: LDALTGFVVAPLFTYLVIGTLFIAAGLVALFKIRSNLQKDGTKTDKLERL

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

47kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_036325.2

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SARS-CoV-2 Spike S2 Peptide
9123P 0.05 mg

SARS-CoV-2 Spike S2 Peptide

Sign In for Pricing
View Details
Cyclin F, CT (Cyclin-F, F-box only Protein 1, CCNF, FBX1, FBXO1)
312497-01 50 µg

Cyclin F, CT (Cyclin-F, F-box only Protein 1, CCNF, FBX1, FBXO1)

Sign In for Pricing
View Details
Cyclin F, CT (Cyclin-F, F-box only Protein 1, CCNF, FBX1, FBXO1)
312497-02 100 µg

Cyclin F, CT (Cyclin-F, F-box only Protein 1, CCNF, FBX1, FBXO1)

Sign In for Pricing
View Details
LARS2 Antibody
A54225-100UL 100 µL

LARS2 Antibody

Sign In for Pricing
View Details
HMGN2/HMG17 Recombinant Antibody, AbBy Fluor™ 750 Conjugated
bsm-62335R-BF750 100 µL

HMGN2/HMG17 Recombinant Antibody, AbBy Fluor™ 750 Conjugated

Sign In for Pricing
View Details
Phospho-NMDAR2A (Tyr1325) Rabbit Polyclonal Antibody (BF680)
orb2431727 100 µL

Phospho-NMDAR2A (Tyr1325) Rabbit Polyclonal Antibody (BF680)

Sign In for Pricing
View Details