Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

WNT16 Rabbit Polyclonal Antibody (HRP)

WNT16 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

Q9UBV4

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human WNT16

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: REKDQRKIPIHKDDLLYVNKSPNYCVEDKKLGIPGTQGRECNRTSEGADG

Field of Research

Stem Cell & Developmental Biology

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

38kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_476509

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Benzofuran-6-carboxylic Acid
TRC-B285420-250MG 250 mg

Benzofuran-6-carboxylic Acid

Sign In for Pricing
View Details
GPNMB Recombinant Rabbit Monoclonal Antibody [PSH0-82]
HA721511 100 µL

GPNMB Recombinant Rabbit Monoclonal Antibody [PSH0-82]

Sign In for Pricing
View Details
GFAP (ASTRO/789), CF594 conjugate, 0.1mg/mL
BNC940789-100 1x 100 µL

GFAP (ASTRO/789), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Complement C4A (C4A) Mouse Monoclonal Antibody [Clone ID: C4D204]
AM32820PU-S 100 µg

Complement C4A (C4A) Mouse Monoclonal Antibody [Clone ID: C4D204]

Sign In for Pricing
View Details
Fmoc-Tyr (t-Bu) Wang Resin
H0751501326.5G 5 g

Fmoc-Tyr (t-Bu) Wang Resin

Sign In for Pricing
View Details
OAZ1 Human Gene Knockout Kit (CRISPR)
KN423468 1 Kit

OAZ1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details