Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

WNT16 Rabbit Polyclonal Antibody (HRP)

WNT16 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

Q9UBV4

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human WNT16

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: REKDQRKIPIHKDDLLYVNKSPNYCVEDKKLGIPGTQGRECNRTSEGADG

Field of Research

Stem Cell & Developmental Biology

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

38kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_476509

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FOXC2 Human Gene Knockout Kit (CRISPR)
KN423412 1 Kit

FOXC2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
PRPF40B (NM_001031698) Human Recombinant Protein
TP309144M 100 µg

PRPF40B (NM_001031698) Human Recombinant Protein

Sign In for Pricing
View Details
Human Interleukin 18 Binding Protein (IL18BP) ELISA Kit
RDR-IL18BP-Hu-01 96 Tests

Human Interleukin 18 Binding Protein (IL18BP) ELISA Kit

Sign In for Pricing
View Details
Human Interleukin 18 Binding Protein (IL18BP) ELISA Kit
RDR-IL18BP-Hu-02 48 Tests

Human Interleukin 18 Binding Protein (IL18BP) ELISA Kit

Sign In for Pricing
View Details
Prss32 Mouse Gene Knockout Kit (CRISPR)
KN514033 1 Kit

Prss32 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Frozen Tissue Blocks, Ovary: left
CB515667 1 Block

Frozen Tissue Blocks, Ovary: left

Sign In for Pricing
View Details