Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rhou Rabbit Polyclonal Antibody (HRP)

Rhou Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Ar, Arhu, G28K, WRCH, WRCH-, WRCH1, mG28K, CDC42L, WRCH-1, CDC42L1, AI182090, 2310026M05Rik

UniProt

Q9EQT3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GRGRAGGAEGRGVKCVLVGDGAVGKTSLVVSYTTNGYPTEYIPTAFDNFS

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

28kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_598716

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DES Polyclonal Antibody
E-AB-65789-01 60 µL

DES Polyclonal Antibody

Sign In for Pricing
View Details
DES Polyclonal Antibody
E-AB-65789-02 120 µL

DES Polyclonal Antibody

Sign In for Pricing
View Details
DES Polyclonal Antibody
E-AB-65789-03 200 µL

DES Polyclonal Antibody

Sign In for Pricing
View Details
APM2 (ADIRF) Human Gene Knockout Kit (CRISPR)
KN402414 1 Kit

APM2 (ADIRF) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant Human Carboxypeptidase B1/CPB1 Protein (His Tag)
PKSH031567 50 µg

Recombinant Human Carboxypeptidase B1/CPB1 Protein (His Tag)

Sign In for Pricing
View Details
Human KCTD21 activation kit by CRISPRa
GA116999 1 Kit

Human KCTD21 activation kit by CRISPRa

Sign In for Pricing
View Details