Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rhou Rabbit Polyclonal Antibody (HRP)

Rhou Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Ar, Arhu, G28K, WRCH, WRCH-, WRCH1, mG28K, CDC42L, WRCH-1, CDC42L1, AI182090, 2310026M05Rik

UniProt

Q9EQT3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GRGRAGGAEGRGVKCVLVGDGAVGKTSLVVSYTTNGYPTEYIPTAFDNFS

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

28kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_598716

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

P Glycoprotein Rabbit Polyclonal Antibody
HA500502 100 µL

P Glycoprotein Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
MUC16 / CA125 (Ovarian Carcinoma Marker) (OCA125/2349R), 0.2mg/mL
BNUB2349-100 1x 100 µL

MUC16 / CA125 (Ovarian Carcinoma Marker) (OCA125/2349R), 0.2mg/mL

Sign In for Pricing
View Details
Recombinant TSGA10IP Antibody
RN-023-01 50 μL

Recombinant TSGA10IP Antibody

Sign In for Pricing
View Details
Recombinant TSGA10IP Antibody
RN-023-02 100 µL

Recombinant TSGA10IP Antibody

Sign In for Pricing
View Details
Recombinant TSGA10IP Antibody
RN-023-03 1 mL

Recombinant TSGA10IP Antibody

Sign In for Pricing
View Details
DHRS12 (NM_001031719) Human Over-expression Lysate
LY422169 100 µg

DHRS12 (NM_001031719) Human Over-expression Lysate

Sign In for Pricing
View Details