Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RHOU Rabbit Polyclonal Antibody (Biotin)

RHOU Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

ARHU, G28K, WRCH1, hG28K, CDC42L1

UniProt

Q7L0Q8

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human RHOU

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: LKEVFDAAIVAGIQYSDTQQQPKKSKSRTPDKMKNLSKSWWKKYCCFV

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

28kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_067028

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLURP1 (Secreted Ly-6/uPAR-related Protein 1, SLURP-1, Anti-neoplastic Urinary Protein, ANUP, ARS Component B, ArsB, ARS (component B) -81/S, ARS, LY6LS, MDM) (AP) discontinued
133529-AP 100 µL

SLURP1 (Secreted Ly-6/uPAR-related Protein 1, SLURP-1, Anti-neoplastic Urinary Protein, ANUP, ARS Component B, ArsB, ARS (component B) -81/S, ARS, LY6LS, MDM) (AP) discontinued

Sign In for Pricing
View Details
Human TEX14 Protein Lysate
MBS8428433-01 0.02 mg

Human TEX14 Protein Lysate

Sign In for Pricing
View Details
Human TEX14 Protein Lysate
MBS8428433-02 5x 0.02 mg

Human TEX14 Protein Lysate

Sign In for Pricing
View Details
V-ATPase A1 Lentiviral Activation Particles (h2)
sc-400975-LAC-2 200 µL

V-ATPase A1 Lentiviral Activation Particles (h2)

Sign In for Pricing
View Details
17β-HSD13 Double Nickase Plasmid (h2)
sc-415608-NIC-2 20 µg

17β-HSD13 Double Nickase Plasmid (h2)

Sign In for Pricing
View Details
Olr1708 sgRNA CRISPR Lentivector (Rat) (Target 1)
K7352102 1.0 µg DNA

Olr1708 sgRNA CRISPR Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details