Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RHOU Rabbit Polyclonal Antibody (Biotin)

RHOU Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

ARHU, G28K, WRCH1, hG28K, CDC42L1

UniProt

Q7L0Q8

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human RHOU

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: LKEVFDAAIVAGIQYSDTQQQPKKSKSRTPDKMKNLSKSWWKKYCCFV

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

28kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_067028

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human IL-8 ELISA Kit
E019516 1 Each

Human IL-8 ELISA Kit

Sign In for Pricing
View Details
DCBLD1 Rabbit Polyclonal Antibody (HRP)
orb3128436 100 µg

DCBLD1 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
POC1B Antibody
CSB-PA855046ESR2HU-01 50 μL

POC1B Antibody

Sign In for Pricing
View Details
POC1B Antibody
CSB-PA855046ESR2HU-02 100 µL

POC1B Antibody

Sign In for Pricing
View Details
Cytadherence High Molecular Weight Protein 1, Recombinant, Mycoplasma pneumoniae, aa1-139, His-Tag, Myc-Tag
584140-01 20 µg

Cytadherence High Molecular Weight Protein 1, Recombinant, Mycoplasma pneumoniae, aa1-139, His-Tag, Myc-Tag

Sign In for Pricing
View Details
Cytadherence High Molecular Weight Protein 1, Recombinant, Mycoplasma pneumoniae, aa1-139, His-Tag, Myc-Tag
584140-02 100 µg

Cytadherence High Molecular Weight Protein 1, Recombinant, Mycoplasma pneumoniae, aa1-139, His-Tag, Myc-Tag

Sign In for Pricing
View Details