Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RHOU Rabbit Polyclonal Antibody (HRP)

RHOU Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

ARHU, G28K, WRCH1, hG28K, CDC42L1

UniProt

Q7L0Q8

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human RHOU

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LKEVFDAAIVAGIQYSDTQQQPKKSKSRTPDKMKNLSKSWWKKYCCFV

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

28kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_067028

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal NGFR/TNFRSF16/p75NTR Antibody (SPM299) [Alexa Fluor 532]
NBP3-11470AF532 0.1 mL

Mouse Monoclonal NGFR/TNFRSF16/p75NTR Antibody (SPM299) [Alexa Fluor 532]

Sign In for Pricing
View Details
SLC2A7 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
44105066 1.0 µg DNA

SLC2A7 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Rabbit Polyclonal TBC1D8B Antibody
NBP1-82190-25ul 25 µL

Rabbit Polyclonal TBC1D8B Antibody

Sign In for Pricing
View Details
NCOA5 ORF Vector (Human) (pORF)
ORF006953 1.0 µg DNA

NCOA5 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Human MMP-2 Alexa Fluor 488 Antibody (Clone 1A10)
IC903G-100UG 100 µg

Human MMP-2 Alexa Fluor 488 Antibody (Clone 1A10)

Sign In for Pricing
View Details
TMEM184B Protein Vector (Mouse) (pPM-C-HA)
PV239340 500 ng

TMEM184B Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details