Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NKD2 Rabbit Polyclonal Antibody (Biotin)

NKD2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Naked2

UniProt

Q96EK8

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human NKD2

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: ARDKQELPNGDPKEGPFREDQCPLQVALPAEKAEGREHPGQLLSADDGER

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

34kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Equine, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

AAH12176

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DTX1 (Deltex Homolog 1, Deltex-1)
D9643-01 100 µg

DTX1 (Deltex Homolog 1, Deltex-1)

Sign In for Pricing
View Details
Human General Transcription Factor IIF (GTF2F1) ELISA Kit
YP-W18054-01 48 Tests

Human General Transcription Factor IIF (GTF2F1) ELISA Kit

Sign In for Pricing
View Details
Human General Transcription Factor IIF (GTF2F1) ELISA Kit
YP-W18054-02 96 Tests

Human General Transcription Factor IIF (GTF2F1) ELISA Kit

Sign In for Pricing
View Details
RAB23 Antibody
orb1328525 100 µg

RAB23 Antibody

Sign In for Pricing
View Details
Pim1, CT (PIM-1, Oncogene PIM1, Oncogene PIM-1, Pim1 Kinase, Pim-1 Kinase, Pim1 Oncogene, Pim-1 Oncogene, PIM, Proto-oncogene Serine/threonine-protein Kinase Pim-1, Proto-oncogene Serine/threonine Protein Kinase Pim1) (MaxLight 490) discontinued
P4186-60F-ML490 100 µL

Pim1, CT (PIM-1, Oncogene PIM1, Oncogene PIM-1, Pim1 Kinase, Pim-1 Kinase, Pim1 Oncogene, Pim-1 Oncogene, PIM, Proto-oncogene Serine/threonine-protein Kinase Pim-1, Proto-oncogene Serine/threonine Protein Kinase Pim1) (MaxLight 490) discontinued

Sign In for Pricing
View Details
12:0 Biotinyl coenzyme A triammonium
TYD-04030-01 10 mg

12:0 Biotinyl coenzyme A triammonium

Sign In for Pricing
View Details