Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GIPC3 Rabbit Polyclonal Antibody (HRP)

GIPC3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

DFNB15, DFNB72, DFNB95, C19orf64

UniProt

Q8TF64

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human GIPC3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: TLRLRSGGAATVEEAPSEFEEEASRKVDDLLESYMGIRDPELASTMVETS

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

34kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Guinea pig, Human, Rat

Tested Applications

WB

NCBI Accession Number

NP_573568

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IL-4 Protein, Canine, Recombinant
TMPY-02790-01 5 µg

IL-4 Protein, Canine, Recombinant

Sign In for Pricing
View Details
IL-4 Protein, Canine, Recombinant
TMPY-02790-02 10 µg

IL-4 Protein, Canine, Recombinant

Sign In for Pricing
View Details
IL-4 Protein, Canine, Recombinant
TMPY-02790-03 20 µg

IL-4 Protein, Canine, Recombinant

Sign In for Pricing
View Details
IL-4 Protein, Canine, Recombinant
TMPY-02790-04 50 µg

IL-4 Protein, Canine, Recombinant

Sign In for Pricing
View Details
IL-4 Protein, Canine, Recombinant
TMPY-02790-05 100 µg

IL-4 Protein, Canine, Recombinant

Sign In for Pricing
View Details
Lentiviral human RUNDC1 sgRNA gene knockout kit - Lentiviral human RUNDC1 sgRNA gene knockout kit (25)
GTR15374439 1 Vial

Lentiviral human RUNDC1 sgRNA gene knockout kit - Lentiviral human RUNDC1 sgRNA gene knockout kit (25)

Sign In for Pricing
View Details