Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BRWD1 Rabbit Polyclonal Antibody (FITC)

BRWD1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

N143, WDR9, WRD9, DCAF19, C21orf107

UniProt

Q6P2D1

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human BRWD1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: MAEPSSARRPVPLIESELYFLIARYLSAGPCRRAAQVLVQELEQYQLLPK

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

13kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rat

Tested Applications

WB

NCBI Accession Number

NP_001007247

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TICAM1 Protein Lysate (Mouse) with C-HA Tag
46690034 100 µg

TICAM1 Protein Lysate (Mouse) with C-HA Tag

Sign In for Pricing
View Details
MARK3, CT (MAP/microtubule Affinity-regulating Kinase 3, Cdc25C-associated Protein Kinase 1, cTAK1, C-TAK1, ELKL Motif Kinase 2, EMK2, EMK-2, KP78, Protein Kinase STK10, Ser/Thr Protein Kinase PAR-1, PAR1A, Par-1a, Serine/threonine-protein Kinase p78) (PE) discontinued
M2407-95A-PE 200 µL

MARK3, CT (MAP/microtubule Affinity-regulating Kinase 3, Cdc25C-associated Protein Kinase 1, cTAK1, C-TAK1, ELKL Motif Kinase 2, EMK2, EMK-2, KP78, Protein Kinase STK10, Ser/Thr Protein Kinase PAR-1, PAR1A, Par-1a, Serine/threonine-protein Kinase p78) (PE) discontinued

Sign In for Pricing
View Details
CHD3 Rabbit Polyclonal Antibody (Biotin)
orb2140059 100 µL

CHD3 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
Recombinant Interleukin 6 (IL6)
SIPA051Eq01-01 10 µg

Recombinant Interleukin 6 (IL6)

Sign In for Pricing
View Details
Recombinant Interleukin 6 (IL6)
SIPA051Eq01-02 50 µg

Recombinant Interleukin 6 (IL6)

Sign In for Pricing
View Details
Recombinant Interleukin 6 (IL6)
SIPA051Eq01-03 200 µg

Recombinant Interleukin 6 (IL6)

Sign In for Pricing
View Details