Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

WDR7 Rabbit Polyclonal Antibody (FITC)

WDR7 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

TRAG

UniProt

Q9Y4E6

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human WDR7

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: LYDIRTGKCQTIHGHKGPITAVAFAPDGRYLATYSNTDSHISFWQMNTSL

Purification

Affinity purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

163kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

XP_006722494

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SH3BP5 (NM_004844) Human Over-expression Lysate
LC417710 20 µg

SH3BP5 (NM_004844) Human Over-expression Lysate

Sign In for Pricing
View Details
ZFYVE20 (Rabenosyn-5, 110kD Protein, FYVE Finger-Containing Rab5 Effector Protein rabenosyn-5, RAB Effector RBSN) (AP)
MBS6460441-01 0.2 mL

ZFYVE20 (Rabenosyn-5, 110kD Protein, FYVE Finger-Containing Rab5 Effector Protein rabenosyn-5, RAB Effector RBSN) (AP)

Sign In for Pricing
View Details
ZFYVE20 (Rabenosyn-5, 110kD Protein, FYVE Finger-Containing Rab5 Effector Protein rabenosyn-5, RAB Effector RBSN) (AP)
MBS6460441-02 5x 0.2 mL

ZFYVE20 (Rabenosyn-5, 110kD Protein, FYVE Finger-Containing Rab5 Effector Protein rabenosyn-5, RAB Effector RBSN) (AP)

Sign In for Pricing
View Details
CD84 shRNA (h) Lentiviral Particles
sc-42810-V 200 µL

CD84 shRNA (h) Lentiviral Particles

Sign In for Pricing
View Details
MAVS Conjugated Antibody
orb1624354 100 µL

MAVS Conjugated Antibody

Sign In for Pricing
View Details
MCCC2 (MCCB, Methylcrotonoyl-CoA Carboxylase beta Chain, Mitochondrial, 3-methylcrotonyl-CoA Carboxylase 2, 3-methylcrotonyl-CoA Carboxylase Non-biotin-containing Subunit, 3-methylcrotonyl-CoA:carbon Dioxide Ligase Subunit beta) (FITC)
129484-FITC 100 µL

MCCC2 (MCCB, Methylcrotonoyl-CoA Carboxylase beta Chain, Mitochondrial, 3-methylcrotonyl-CoA Carboxylase 2, 3-methylcrotonyl-CoA Carboxylase Non-biotin-containing Subunit, 3-methylcrotonyl-CoA:carbon Dioxide Ligase Subunit beta) (FITC)

Sign In for Pricing
View Details