Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MSH4 Rabbit Polyclonal Antibody (Biotin)

MSH4 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

UniProt

O15457

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human MSH4

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: SSARDTNYPQTLKTPLSTGNPQRSGYKSWTPQVGYSASSSSAISAHSPSV

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

105kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_002431

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LRRTM1, ID (LRRTM1, Leucine-rich repeat transmembrane neuronal protein 1) (PE) discontinued
037986-PE 200 µL

LRRTM1, ID (LRRTM1, Leucine-rich repeat transmembrane neuronal protein 1) (PE) discontinued

Sign In for Pricing
View Details
Recombinant Human Kinesin light chain 1 (KLC1)
orb3005005-01 20 µg

Recombinant Human Kinesin light chain 1 (KLC1)

Sign In for Pricing
View Details
Recombinant Human Kinesin light chain 1 (KLC1)
orb3005005-02 100 µg

Recombinant Human Kinesin light chain 1 (KLC1)

Sign In for Pricing
View Details
Recombinant Human Kinesin light chain 1 (KLC1)
orb3005005-03 1 mg

Recombinant Human Kinesin light chain 1 (KLC1)

Sign In for Pricing
View Details
Cytohesin 1 (CYTH1) Human Over-expression Lysate
orb1349072 100 µg

Cytohesin 1 (CYTH1) Human Over-expression Lysate

Sign In for Pricing
View Details
Lentiviral mouse Reg4 shRNA (UAS) - Lentiviral mouse Reg4 shRNA (UAS, iRFP) (100)
GTR15220575 1 Vial

Lentiviral mouse Reg4 shRNA (UAS) - Lentiviral mouse Reg4 shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details