Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MSH4 Rabbit Polyclonal Antibody (Biotin)

MSH4 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

UniProt

O15457

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human MSH4

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: SSARDTNYPQTLKTPLSTGNPQRSGYKSWTPQVGYSASSSSAISAHSPSV

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

105kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_002431

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human HPSE shRNA (UAS) - Lentiviral human HPSE shRNA (UAS, GFP) (100)
GTR15345972 1 Vial

Lentiviral human HPSE shRNA (UAS) - Lentiviral human HPSE shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
PRMT5 (Protein Arginine N-methyltransferase 5, 72kD ICln-binding Protein, Histone-arginine N-methyltransferase PRMT5, HRMT1L5, IBP72, Jak-binding Protein 1, JBP1, Shk1 Kinase-binding Protein 1 Homolog, SKB1 Homolog, SKB1Hs, SKB1) (HRP)
131838-HRP 100 µL

PRMT5 (Protein Arginine N-methyltransferase 5, 72kD ICln-binding Protein, Histone-arginine N-methyltransferase PRMT5, HRMT1L5, IBP72, Jak-binding Protein 1, JBP1, Shk1 Kinase-binding Protein 1 Homolog, SKB1 Homolog, SKB1Hs, SKB1) (HRP)

Sign In for Pricing
View Details
ANKRD60, CT (ANKRD60, C20orf86, Ankyrin repeat domain-containing protein 60) (MaxLight 550) discontinued
031904-ML550 100 µL

ANKRD60, CT (ANKRD60, C20orf86, Ankyrin repeat domain-containing protein 60) (MaxLight 550) discontinued

Sign In for Pricing
View Details
Urea-PAGE Preparation Kit for RNA
R0218S 20 - 30 Gels

Urea-PAGE Preparation Kit for RNA

Sign In for Pricing
View Details
Monoclonal Antibody to C-Peptide (CP)
MBS2025818-01 0.1 mL

Monoclonal Antibody to C-Peptide (CP)

Sign In for Pricing
View Details
Monoclonal Antibody to C-Peptide (CP)
MBS2025818-02 0.2 mL

Monoclonal Antibody to C-Peptide (CP)

Sign In for Pricing
View Details