Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MSH5 Rabbit Polyclonal Antibody (Biotin)

MSH5 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

G7, NG23, POF13, MUTSH5

UniProt

O43196

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human MSH5

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: DENMTRFLGKLASQEHREPKRPEIIFLPSVDFGLEISKQRLLSGNYSFIP

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

93kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_751897

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HSC 70 Polyclonal Antibody
RA30694-01 50 µL

HSC 70 Polyclonal Antibody

Sign In for Pricing
View Details
HSC 70 Polyclonal Antibody
RA30694-02 100 µL

HSC 70 Polyclonal Antibody

Sign In for Pricing
View Details
AKR7L (Aflatoxin B1 Aldehyde Reductase Member 4, 1, AFB1 Aldehyde Reductase 3, AFB1-AR 3, Aldoketoreductase 7-like, AKR7L, AFAR3, AKR7A4) (APC)
MBS6454128-01 0.2 mL

AKR7L (Aflatoxin B1 Aldehyde Reductase Member 4, 1, AFB1 Aldehyde Reductase 3, AFB1-AR 3, Aldoketoreductase 7-like, AKR7L, AFAR3, AKR7A4) (APC)

Sign In for Pricing
View Details
AKR7L (Aflatoxin B1 Aldehyde Reductase Member 4, 1, AFB1 Aldehyde Reductase 3, AFB1-AR 3, Aldoketoreductase 7-like, AKR7L, AFAR3, AKR7A4) (APC)
MBS6454128-02 5x 0.2 mL

AKR7L (Aflatoxin B1 Aldehyde Reductase Member 4, 1, AFB1 Aldehyde Reductase 3, AFB1-AR 3, Aldoketoreductase 7-like, AKR7L, AFAR3, AKR7A4) (APC)

Sign In for Pricing
View Details
ADO antibody
FNab10394 100 µg

ADO antibody

Sign In for Pricing
View Details
Hormonally Up-Regulated Neu Tumor-Associated Kinase (Hunk) Antibody
abx028312-01 80 µL

Hormonally Up-Regulated Neu Tumor-Associated Kinase (Hunk) Antibody

Sign In for Pricing
View Details