Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MSH5 Rabbit Polyclonal Antibody (HRP)

MSH5 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

G7, NG23, POF13, MUTSH5

UniProt

O43196

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human MSH5

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: DENMTRFLGKLASQEHREPKRPEIIFLPSVDFGLEISKQRLLSGNYSFIP

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

93kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_751897

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat ALDOC (Aldolase C, Fructose Bisphosphate) ELISA Kit
MBS8805160-01 48 Well

Rat ALDOC (Aldolase C, Fructose Bisphosphate) ELISA Kit

Sign In for Pricing
View Details
Rat ALDOC (Aldolase C, Fructose Bisphosphate) ELISA Kit
MBS8805160-02 96 Well

Rat ALDOC (Aldolase C, Fructose Bisphosphate) ELISA Kit

Sign In for Pricing
View Details
Rat ALDOC (Aldolase C, Fructose Bisphosphate) ELISA Kit
MBS8805160-03 5x 96 Well

Rat ALDOC (Aldolase C, Fructose Bisphosphate) ELISA Kit

Sign In for Pricing
View Details
Rat ALDOC (Aldolase C, Fructose Bisphosphate) ELISA Kit
MBS8805160-04 10x 96 Well

Rat ALDOC (Aldolase C, Fructose Bisphosphate) ELISA Kit

Sign In for Pricing
View Details
Anti-Human APP/Amyloid beta Antibody (12B4)
HY235053-01 50 µg

Anti-Human APP/Amyloid beta Antibody (12B4)

Sign In for Pricing
View Details
Anti-Human APP/Amyloid beta Antibody (12B4)
HY235053-02 100 µg

Anti-Human APP/Amyloid beta Antibody (12B4)

Sign In for Pricing
View Details