Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SERPIND1 Rabbit Polyclonal Antibody (FITC)

SERPIND1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

HC2, LS2, HCF2, HCII, HLS2, THPH10, D22S673

UniProt

P05546

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human SERPIND1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: VSMMQTKGNFLAANDQELDCDILQLEYVGGISMLIVVPHKMSGMKTLEAQ

Field of Research

Immunology & Inflammation

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

55kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_000176

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Zinc finger protein 277, ZNF277 ELISA Kit
MBS9318298-01 48 Well

Human Zinc finger protein 277, ZNF277 ELISA Kit

Sign In for Pricing
View Details
Human Zinc finger protein 277, ZNF277 ELISA Kit
MBS9318298-02 96 Well

Human Zinc finger protein 277, ZNF277 ELISA Kit

Sign In for Pricing
View Details
Human Zinc finger protein 277, ZNF277 ELISA Kit
MBS9318298-03 5x 96 Well

Human Zinc finger protein 277, ZNF277 ELISA Kit

Sign In for Pricing
View Details
Human Zinc finger protein 277, ZNF277 ELISA Kit
MBS9318298-04 10x 96 Well

Human Zinc finger protein 277, ZNF277 ELISA Kit

Sign In for Pricing
View Details
PPDK Antibody
orb28101-01 50 µg

PPDK Antibody

Sign In for Pricing
View Details
PPDK Antibody
orb28101-02 100 µg

PPDK Antibody

Sign In for Pricing
View Details