Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Insr Rabbit Polyclonal Antibody (Biotin)

Insr Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

I, IR, IR-A, IR-B, CD220, 4932439J01Rik, D630014A15Rik

UniProt

P15208

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: EEVSGTKGRQERNDIALKTNGDQASCENELLKFSFIRTSFDKILLRWEPY

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

155kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep

Tested Applications

WB

NCBI Accession Number

NP_034698

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-Caenorhabditis elegans snr-5 Polyclonal Antibody
MBS7155293 Inquire

Rabbit anti-Caenorhabditis elegans snr-5 Polyclonal Antibody

Sign In for Pricing
View Details
Anti-RPS21 Antibody Picoband®, FITC Conjugate
A10068-2-FITC 100 µg/Vial

Anti-RPS21 Antibody Picoband®, FITC Conjugate

Sign In for Pricing
View Details
GPN3 Antibody - C-terminal region : Biotin (ARP62840_P050-Biotin)
ARP62840_P050-Biotin 100 µL

GPN3 Antibody - C-terminal region : Biotin (ARP62840_P050-Biotin)

Sign In for Pricing
View Details
Pctp Rat shRNA Lentiviral Particle (Locus ID 29510)
TL710026V 500 µL Each

Pctp Rat shRNA Lentiviral Particle (Locus ID 29510)

Sign In for Pricing
View Details
Tissue Inhibitor of Metalloproteinases 3 (Tissue Inhibitor of Metalloproteinase 3, Tissue Inhibitor of Metalloproteinases-3, TIMP Metallopeptidase Inhibitor 3, TIMP 3, TIMP3, TIMP-3, HSMRK222, K222, K222TA2, Metalloproteinase Inhibitor 3, MIG 5 Protein, MIG-5 Protein, Protein MIG-5, Sorsby Fundus Dystrophy Pseudoinflammatory, SFD) discontinued
T5587-01D 100 µg

Tissue Inhibitor of Metalloproteinases 3 (Tissue Inhibitor of Metalloproteinase 3, Tissue Inhibitor of Metalloproteinases-3, TIMP Metallopeptidase Inhibitor 3, TIMP 3, TIMP3, TIMP-3, HSMRK222, K222, K222TA2, Metalloproteinase Inhibitor 3, MIG 5 Protein, MIG-5 Protein, Protein MIG-5, Sorsby Fundus Dystrophy Pseudoinflammatory, SFD) discontinued

Sign In for Pricing
View Details
Rabbit Polyclonal ZBTB3 Antibody [DyLight 488]
NBP2-32140G 0.1 mL

Rabbit Polyclonal ZBTB3 Antibody [DyLight 488]

Sign In for Pricing
View Details