Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

INSR Rabbit Polyclonal Antibody (FITC)

INSR Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

HHF5, CD220

UniProt

P06213

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human INSR

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: ENNVVHLMWQEPKEPNGLIVLYEVSYRRYGDEELHLCVSRKHFALERGCR

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

154kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

IHC, WB

NCBI Accession Number

NP_000199

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PED/PEA-15, CT (15kD Phosphoprotein Enriched in Astrocytes, Phosphoprotein Enriched in Astrocytes 15kD, Phosphoprotein Enriched in Astrocytes 15, PEA15, PEA-15 Protein, Phosphoprotein Enriched in Diabetes, PED, Astrocytic Phosphoprotein PEA-15, HMAT1, HUM
MBS6492585-01 0.1 mL

PED/PEA-15, CT (15kD Phosphoprotein Enriched in Astrocytes, Phosphoprotein Enriched in Astrocytes 15kD, Phosphoprotein Enriched in Astrocytes 15, PEA15, PEA-15 Protein, Phosphoprotein Enriched in Diabetes, PED, Astrocytic Phosphoprotein PEA-15, HMAT1, HUM

Sign In for Pricing
View Details
PED/PEA-15, CT (15kD Phosphoprotein Enriched in Astrocytes, Phosphoprotein Enriched in Astrocytes 15kD, Phosphoprotein Enriched in Astrocytes 15, PEA15, PEA-15 Protein, Phosphoprotein Enriched in Diabetes, PED, Astrocytic Phosphoprotein PEA-15, HMAT1, HUM
MBS6492585-02 5x 0.1 mL

PED/PEA-15, CT (15kD Phosphoprotein Enriched in Astrocytes, Phosphoprotein Enriched in Astrocytes 15kD, Phosphoprotein Enriched in Astrocytes 15, PEA15, PEA-15 Protein, Phosphoprotein Enriched in Diabetes, PED, Astrocytic Phosphoprotein PEA-15, HMAT1, HUM

Sign In for Pricing
View Details
(2R,3S) -1-Chloro-2-hydroxy-3-[ (benzyloxycarbonyl) amino]-4- (phenylthio) butane
421728 2.5 mg

(2R,3S) -1-Chloro-2-hydroxy-3-[ (benzyloxycarbonyl) amino]-4- (phenylthio) butane

Sign In for Pricing
View Details
Rabbit Monoclonal Cytokeratin 7 Antibody (KRT7/8121R) [Janelia Fluor 585]
NBP3-20720JF585 0.1 mL

Rabbit Monoclonal Cytokeratin 7 Antibody (KRT7/8121R) [Janelia Fluor 585]

Sign In for Pricing
View Details
hsa-miR-1297 miRNA Agomir
MBS8311457-01 5 nmol

hsa-miR-1297 miRNA Agomir

Sign In for Pricing
View Details
hsa-miR-1297 miRNA Agomir
MBS8311457-02 10 nmol

hsa-miR-1297 miRNA Agomir

Sign In for Pricing
View Details