Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MORF4L2, Human (His)

The MORF4L2 protein is an important component of the NuA4 histone acetyltransferase complex and promotes transcriptional activation by acetylating histones H4 and H2A. This modification alters nucleosome-DNA interactions and promotes interactions with other transcription-positive proteins. MORF4L2 Protein, Human (His) is the recombinant human-derived MORF4L2 protein, expressed by E. coli , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

MORF4L2 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/morf4l2-protein-human-his.html

Purity

96.60

Smiles

MSSRKQGSQPRGQQSAEEENFKKPTRSNMQRSKMRGASSGKKTAGPQQKNLEPALPGRWGGRSAENPPSGSVRKTRKNKQKTPGNGDGGSTSEAPQPPRKKRARADPTVESEEAFKNRMEVKVKIPEELKPWLVEDWDLVTRQKQLFQLPAKKNVDAILEEYANCKKSQGNVDNKEYAVNEVVAGIKEYFNVMLGTQLLYKFERPQYAEILLAHPDAPMSQVYGAPHLLRLFVRIGAMLAYTPLDEKSLALLLGYLHDFLKYLAKNSASLFTASDYKVASAEYHRKAL

Molecular Formula

9643 (Gene_ID) Q15014 (M1-L288) (Accession)

Molecular Weight

33-36 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Elab Fluor® Red 780 Anti-Mouse CD24 Antibody[M1/69]
E-AB-F1179S-01 50 Tests

Elab Fluor® Red 780 Anti-Mouse CD24 Antibody[M1/69]

Sign In for Pricing
View Details
Elab Fluor® Red 780 Anti-Mouse CD24 Antibody[M1/69]
E-AB-F1179S-02 100 Tests

Elab Fluor® Red 780 Anti-Mouse CD24 Antibody[M1/69]

Sign In for Pricing
View Details
Elab Fluor® Red 780 Anti-Mouse CD24 Antibody[M1/69]
E-AB-F1179S-03 2x 100 Tests

Elab Fluor® Red 780 Anti-Mouse CD24 Antibody[M1/69]

Sign In for Pricing
View Details
Plcxd1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
36957114 3x 1.0 µg

Plcxd1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
O-Tolylbiguanide hydrochloride
EAA75199-01 0.25 g

O-Tolylbiguanide hydrochloride

Sign In for Pricing
View Details
O-Tolylbiguanide hydrochloride
EAA75199-02 2.5 g

O-Tolylbiguanide hydrochloride

Sign In for Pricing
View Details