Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Serpinc1 Rabbit Polyclonal Antibody (HRP)

Serpinc1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

A, At, At-, At3, At-3, ATIII, AI114908

UniProt

P32261

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: AAASTSVVITGRSLNPNRVTFKANRPFLVLIREVALNTIIFMGRVANPCV

Field of Research

Cardiovascular Research

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

52kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep

Tested Applications

WB

NCBI Accession Number

NP_543120

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human CD97 Protein (His Tag)
PKSH031169 100 µg

Recombinant Human CD97 Protein (His Tag)

Sign In for Pricing
View Details
Alkaline Phosphatase Conjugated Bryonia dioica Lectin (White Bryony) -BDA-
LA-8002-1 1 mg

Alkaline Phosphatase Conjugated Bryonia dioica Lectin (White Bryony) -BDA-

Sign In for Pricing
View Details
Ceturegel™ Matrix High Concentration, Phenol Red-Free, LDEV-Free
40188ES08 5 mL

Ceturegel™ Matrix High Concentration, Phenol Red-Free, LDEV-Free

Sign In for Pricing
View Details
Cryptochrome I (CRY1) Rabbit Polyclonal Antibody
TA375114 100 µL

Cryptochrome I (CRY1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CD45RB (DF-B1), CF640R conjugate, 0.1mg/mL
BNC401066-100 1x 100 µL

CD45RB (DF-B1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human SMIM15 activation kit by CRISPRa
GA118682 1 Kit

Human SMIM15 activation kit by CRISPRa

Sign In for Pricing
View Details