Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FBP1 Rabbit Polyclonal Antibody (FITC)

FBP1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

FBP

UniProt

P09467

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human FBP1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: YVVCFDPLDGSSNIDCLVSVGTIFGIYRKKSTDEPSEKDALQPGRNLVAA

Field of Research

Signal Transduction

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

37kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

IHC, WB

NCBI Accession Number

NP_000498

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-PPP1R3A Antibody
A07755 100 µL

Anti-PPP1R3A Antibody

Sign In for Pricing
View Details
Snx22 3'UTR GFP Stable Cell Line
TU270937 1.0 mL

Snx22 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Elongin A, NT (TCEB3, Transcription elongation factor B polypeptide 3, Elongin 110kD subunit, Elongin-A, RNA polymerase II transcription factor SIII subunit A1, SIII p110) (MaxLight 750) discontinued
035045-ML750 100 µL

Elongin A, NT (TCEB3, Transcription elongation factor B polypeptide 3, Elongin 110kD subunit, Elongin-A, RNA polymerase II transcription factor SIII subunit A1, SIII p110) (MaxLight 750) discontinued

Sign In for Pricing
View Details
GATAD2A Double Nickase Plasmid (h2)
sc-405429-NIC-2 20 µg

GATAD2A Double Nickase Plasmid (h2)

Sign In for Pricing
View Details
DHPS Rabbit pAb
E45R26462N-100 100 µL

DHPS Rabbit pAb

Sign In for Pricing
View Details
Human Cyclin-dependent kinase inhibitor-2A (CDKN2A; p16INK4a) ELISA Kit
YP-W11796-01 48 Tests

Human Cyclin-dependent kinase inhibitor-2A (CDKN2A; p16INK4a) ELISA Kit

Sign In for Pricing
View Details