Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CYP2E1 Rabbit Polyclonal Antibody (Biotin)

CYP2E1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

CPE1, CYP2E, P450-J, P450C2E

UniProt

P05181

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human CYP2E1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: QEFPDPEKFKPEHFLNENGKFKYSDYFKPFSTGKRVCAGEGLARMELFLL

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

54kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep

Tested Applications

WB

NCBI Accession Number

NP_000764

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse N6amt1 shRNA (UAS) - Lentiviral mouse N6amt1 shRNA (UAS) plasmid
GTR15294082 1 Vial

Lentiviral mouse N6amt1 shRNA (UAS) - Lentiviral mouse N6amt1 shRNA (UAS) plasmid

Sign In for Pricing
View Details
KLHL38 Antibody, FITC conjugated
CSB-PA652063LC01HU-01 50 µg

KLHL38 Antibody, FITC conjugated

Sign In for Pricing
View Details
KLHL38 Antibody, FITC conjugated
CSB-PA652063LC01HU-02 100 µg

KLHL38 Antibody, FITC conjugated

Sign In for Pricing
View Details
Griffonia (Bandeiraea) simplicifolia GS I (GS-I) (Gold, 20nm)
G8967-17G3 1 mL

Griffonia (Bandeiraea) simplicifolia GS I (GS-I) (Gold, 20nm)

Sign In for Pricing
View Details
Albumin, Pigeon Serum (Alb)
029004 100 µg

Albumin, Pigeon Serum (Alb)

Sign In for Pricing
View Details
Recombinant Macaca mulatta (Rhesus macaque) C-C chemokine receptor type 3 (CCR3)
orb2905221-01 20 µg

Recombinant Macaca mulatta (Rhesus macaque) C-C chemokine receptor type 3 (CCR3)

Sign In for Pricing
View Details