Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CYP2E1 Rabbit Polyclonal Antibody (FITC)

CYP2E1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

CPE1, CYP2E, P450-J, P450C2E

UniProt

P05181

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human CYP2E1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: QEFPDPEKFKPEHFLNENGKFKYSDYFKPFSTGKRVCAGEGLARMELFLL

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

54kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep

Tested Applications

WB

NCBI Accession Number

NP_000764

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MARK3 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3E11]
TA805881BM 100 µL

MARK3 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3E11]

Sign In for Pricing
View Details
Human FMS Like Tyrosine Kinase 3 (Flt3) ELISA Kit
RD-Flt3-Hu-01 96 Tests

Human FMS Like Tyrosine Kinase 3 (Flt3) ELISA Kit

Sign In for Pricing
View Details
Human FMS Like Tyrosine Kinase 3 (Flt3) ELISA Kit
RD-Flt3-Hu-02 48 Tests

Human FMS Like Tyrosine Kinase 3 (Flt3) ELISA Kit

Sign In for Pricing
View Details
Bcl2-L-13 Rabbit Polyclonal Antibody
HA500329 100 µL

Bcl2-L-13 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Cox8a Mouse Gene Knockout Kit (CRISPR)
KN503735 1 Kit

Cox8a Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Multi-parameter Analyzer BMET-1100
BMET-1100 1 Unit

Multi-parameter Analyzer BMET-1100

Sign In for Pricing
View Details