Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DDC Rabbit Polyclonal Antibody (FITC)

DDC Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

AADC

UniProt

P20711

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human DDC

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: SLKMWFVFRMYGVKGLQAYIRKHVQLSHEFESLVRQDPRFEICVEVILGL

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

54kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_000781

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human CST8 (NM_001281730) AAV Particle
RC235995A1V 250 µL

Human CST8 (NM_001281730) AAV Particle

Sign In for Pricing
View Details
Human Anti-Thyroid Microsome Anti-body (ATMA) ELISA Kit
NSL0869Hu 96 Tests

Human Anti-Thyroid Microsome Anti-body (ATMA) ELISA Kit

Sign In for Pricing
View Details
HIF PHD3 Lentiviral Activation Particles (h2)
sc-403671-LAC-2 200 µL

HIF PHD3 Lentiviral Activation Particles (h2)

Sign In for Pricing
View Details
PDE4A (NM_001111307) Human Tagged Lenti ORF Clone
RC226235L1 10 µg

PDE4A (NM_001111307) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
PNN, ID (PNN, DRS, MEMA, Pinin, 140kD nuclear and cell adhesion-related phosphoprotein, Desmosome-associated protein, Domain-rich serine protein, Melanoma metastasis clone A protein, Nuclear protein SDK3, SR-like protein) (Azide free) (HRP)
MBS6335349-01 0.2 mL

PNN, ID (PNN, DRS, MEMA, Pinin, 140kD nuclear and cell adhesion-related phosphoprotein, Desmosome-associated protein, Domain-rich serine protein, Melanoma metastasis clone A protein, Nuclear protein SDK3, SR-like protein) (Azide free) (HRP)

Sign In for Pricing
View Details
PNN, ID (PNN, DRS, MEMA, Pinin, 140kD nuclear and cell adhesion-related phosphoprotein, Desmosome-associated protein, Domain-rich serine protein, Melanoma metastasis clone A protein, Nuclear protein SDK3, SR-like protein) (Azide free) (HRP)
MBS6335349-02 5x 0.2 mL

PNN, ID (PNN, DRS, MEMA, Pinin, 140kD nuclear and cell adhesion-related phosphoprotein, Desmosome-associated protein, Domain-rich serine protein, Melanoma metastasis clone A protein, Nuclear protein SDK3, SR-like protein) (Azide free) (HRP)

Sign In for Pricing
View Details