Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PLA2G5 Rabbit Polyclonal Antibody (Biotin)

PLA2G5 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

FRFB, GV-PLA2, PLA2-10, hVPLA (2)

UniProt

P39877

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human PLA2G5

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: MKGLLPLAWFLACSVPAVQGGLLDLKSMIEKVTGKNALTNYGFYGCYCGW

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

14kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_000920

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ham's F-12 W/O L-glutamine and phenol red.
HFL07-6X500ML 6x 500 mL

Ham's F-12 W/O L-glutamine and phenol red.

Sign In for Pricing
View Details
SDHA Recombinant Protein (Human)
RP027847 100 µg

SDHA Recombinant Protein (Human)

Sign In for Pricing
View Details
KCTD13, CT (KCTD13, BACURD1, PDIP1, POLDIP1, BTB/POZ domain-containing adapter for CUL3-mediated RhoA degradation protein 1, BTB/POZ domain-containing protein KCTD13, Polymerase delta-interacting protein 1, TNFAIP1-like protein) (AP) discontinued
037357-AP 200 µL

KCTD13, CT (KCTD13, BACURD1, PDIP1, POLDIP1, BTB/POZ domain-containing adapter for CUL3-mediated RhoA degradation protein 1, BTB/POZ domain-containing protein KCTD13, Polymerase delta-interacting protein 1, TNFAIP1-like protein) (AP) discontinued

Sign In for Pricing
View Details
WDR51B antibody - N-terminal region
MBS3212312-01 0.1 mL

WDR51B antibody - N-terminal region

Sign In for Pricing
View Details
WDR51B antibody - N-terminal region
MBS3212312-02 5x 0.1 mL

WDR51B antibody - N-terminal region

Sign In for Pricing
View Details
Human TTI2 qPCR Primer Pair
QH53169S 200 Tests

Human TTI2 qPCR Primer Pair

Sign In for Pricing
View Details