Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PLA2G5 Rabbit Polyclonal Antibody (HRP)

PLA2G5 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

FRFB, GV-PLA2, PLA2-10, hVPLA (2)

UniProt

P39877

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human PLA2G5

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MKGLLPLAWFLACSVPAVQGGLLDLKSMIEKVTGKNALTNYGFYGCYCGW

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

14kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_000920

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PDK2 Lentiviral Activation Particles (m)
sc-422178-LAC 200 µL

PDK2 Lentiviral Activation Particles (m)

Sign In for Pricing
View Details
Human hsa-miR-3144-3p miRNA Antagomir
abx886177-01 10 nmol

Human hsa-miR-3144-3p miRNA Antagomir

Sign In for Pricing
View Details
Human hsa-miR-3144-3p miRNA Antagomir
abx886177-02 20 nmol

Human hsa-miR-3144-3p miRNA Antagomir

Sign In for Pricing
View Details
Fez2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)
K6941807 1.0 µg DNA

Fez2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
Fibrillin 3 (FBN3) Human ELISA Kit
D3773 96 Tests

Fibrillin 3 (FBN3) Human ELISA Kit

Sign In for Pricing
View Details
Rabbit Anti-Human NFκB-p100 (phospho Ser872) Polyclonal Antibody
PA89825HU-01 50 µg

Rabbit Anti-Human NFκB-p100 (phospho Ser872) Polyclonal Antibody

Sign In for Pricing
View Details