Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AK3L1 Rabbit Polyclonal Antibody (Biotin)

AK3L1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

AK3, AK 4, AK3L1, AK3L2

UniProt

P27144

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human AK3L1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: RWIHPPSGRVYNLDFNPPHVHGIDDVTGEPLVQQEDDKPEAVAARLRQYK

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

25kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001005353

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

STCH (HSPA13) Rabbit Polyclonal Antibody
TA360788 100 µL

STCH (HSPA13) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human VSTM2A activation kit by CRISPRa
GA116654 1 Kit

Human VSTM2A activation kit by CRISPRa

Sign In for Pricing
View Details
DDX11 Rabbit Polyclonal Antibody
TA375382 100 µL

DDX11 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
FAM23A (TMEM236) Human Gene Knockout Kit (CRISPR)
KN420402 1 Kit

FAM23A (TMEM236) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Borrelia burgdorferi (p41 Flagellin) (6802), CF640R conjugate, 0.1mg/mL
BNC400144-100 1x 100 µL

Borrelia burgdorferi (p41 Flagellin) (6802), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Protein A/G Coated - 96 well plates - 8 Well Breakable Strips on single well holding frame - Clear PS
MG08F-PAG/W 10x 96 Well Plates

Protein A/G Coated - 96 well plates - 8 Well Breakable Strips on single well holding frame - Clear PS

Sign In for Pricing
View Details