Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AK3L1 Rabbit Polyclonal Antibody (Biotin)

AK3L1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

AK3, AK 4, AK3L1, AK3L2

UniProt

P27144

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human AK3L1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: RWIHPPSGRVYNLDFNPPHVHGIDDVTGEPLVQQEDDKPEAVAARLRQYK

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

25kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001005353

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Propiolic Acid
TRC-P827860-50G 50 g

Propiolic Acid

Sign In for Pricing
View Details
Dicresulene Hydrate
TRC-D437790-5MG 5 mg

Dicresulene Hydrate

Sign In for Pricing
View Details
Zup1 Mouse Gene Knockout Kit (CRISPR)
KN520170 1 Kit

Zup1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
TMEM238 (NM_001190764) Human Over-expression Lysate
LC434016 20 µg

TMEM238 (NM_001190764) Human Over-expression Lysate

Sign In for Pricing
View Details
Kappa Light Chain (TB28-2), CF640R conjugate, 0.1mg/mL
BNC400708-100 1x 100 µL

Kappa Light Chain (TB28-2), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Phospho-GSK3 (alpha + beta) (Y216 + Y279) Recombinant Rabbit Monoclonal Antibody [SY26-05]
ET1607-54 100 µL

Phospho-GSK3 (alpha + beta) (Y216 + Y279) Recombinant Rabbit Monoclonal Antibody [SY26-05]

Sign In for Pricing
View Details