Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AK3L1 Rabbit Polyclonal Antibody (HRP)

AK3L1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

AK3, AK 4, AK3L1, AK3L2

UniProt

P27144

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human AK3L1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: RWIHPPSGRVYNLDFNPPHVHGIDDVTGEPLVQQEDDKPEAVAARLRQYK

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

25kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001005353

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ALDH3A1 (NM_001135167) Human Over-expression Lysate
LC427569 20 µg

ALDH3A1 (NM_001135167) Human Over-expression Lysate

Sign In for Pricing
View Details
PTN Recombinant Rabbit Monoclonal Antibody [JE47-40]
HA722055 100 µL

PTN Recombinant Rabbit Monoclonal Antibody [JE47-40]

Sign In for Pricing
View Details
Rpl37a Mouse Gene Knockout Kit (CRISPR)
KN515046 1 Kit

Rpl37a Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Biotin Conjugated Rabbit Polyclonal Antibody to Chicken IgY,
BAF-2354-1 1 mL

Biotin Conjugated Rabbit Polyclonal Antibody to Chicken IgY,

Sign In for Pricing
View Details
ALDH4A1 Recombinant Mouse monoclonal Antibody
HA610192 100 µg

ALDH4A1 Recombinant Mouse monoclonal Antibody

Sign In for Pricing
View Details
Recombinant SARS-CoV-2 Spike RBD (K417N) (His Tag)
PKSV030364 100 µg

Recombinant SARS-CoV-2 Spike RBD (K417N) (His Tag)

Sign In for Pricing
View Details