Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Hao2 Rabbit Polyclonal Antibody (Biotin)

Hao2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Ha, Hao3, Hao-2, Haox3, AI325478

UniProt

Q9NYQ2

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: IRGIIVSNHGGRQLDEVPASIDALREVVAAVNGKIEVYMDGGVRTGNDVL

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

39kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rat

Tested Applications

WB

NCBI Accession Number

NP_062418

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Tbk1 activation kit by CRISPRa
GA205996 1 Kit

Mouse Tbk1 activation kit by CRISPRa

Sign In for Pricing
View Details
10000?l tip box with ultra low retention tip BPIC-717
BPIC-717 1 Unit

10000?l tip box with ultra low retention tip BPIC-717

Sign In for Pricing
View Details
Magnesium Chloride Anhydrous
TRC-M110333-500G 500 g

Magnesium Chloride Anhydrous

Sign In for Pricing
View Details
STAT2 (STAT2/2650), CF568 conjugate, 0.1mg/mL
BNC682650-100 1x 100 µL

STAT2 (STAT2/2650), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PADI2 Human Gene Knockout Kit (CRISPR)
KN423889 1 Kit

PADI2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
GSPT2 Rabbit Polyclonal Antibody
TA366318 100 µL

GSPT2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details