Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC13A3 Rabbit Polyclonal Antibody (HRP)

SLC13A3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

NADC3, SDCT2, ARLIAK

UniProt

Q8WWT9

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human SLC13A3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MAVYWCTEALPLSVTALLPIVLFPFMGILPSNKVCPQYFLDTNFLFLSGL

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

66kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_073740

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bovine A Disintegrin and Metalloprotease 22 ELISA Kit
OM624913 96 Strip Well

Bovine A Disintegrin and Metalloprotease 22 ELISA Kit

Sign In for Pricing
View Details
RAP1 rabbit pAb Antibody
orb766201-01 50 μL

RAP1 rabbit pAb Antibody

Sign In for Pricing
View Details
RAP1 rabbit pAb Antibody
orb766201-02 100 µL

RAP1 rabbit pAb Antibody

Sign In for Pricing
View Details
Treble Frame Set 07 in Silver with Yellow Trays - EACH
SED1026V 1 Each

Treble Frame Set 07 in Silver with Yellow Trays - EACH

Sign In for Pricing
View Details
Mouse FGF21 ELISA Kit
orb315110 96 Tests

Mouse FGF21 ELISA Kit

Sign In for Pricing
View Details
Basic Hair Keratin, K82 (KRT82, Keratin 82, HB2, Hb-2, K82, Keratin, type II cuticular Hb2, Keratin-82, KRTHB2, Type II hair keratin Hb2) (Not for Export EU)
B0130-20 100 µL

Basic Hair Keratin, K82 (KRT82, Keratin 82, HB2, Hb-2, K82, Keratin, type II cuticular Hb2, Keratin-82, KRTHB2, Type II hair keratin Hb2) (Not for Export EU)

Sign In for Pricing
View Details